PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr022066.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family LBD
Protein Properties Length: 231aa    MW: 25063.5 Da    PI: 6.7507
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr022066.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260133.96.1e-42751741100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+C+++Cvlapyfp ++p kf ++h++FGasn++kll+++pe++r da+ss+vyeA+ar+rdPvyG++g i +lq+q+ +l+a+la+++
  Pbr022066.1  75 PCAACKILRRRCVEKCVLAPYFPPTEPLKFTIAHRVFGASNIIKLLQEIPESHRADAVSSMVYEANARIRDPVYGCAGAICQLQKQVGELQAQLAKAQ 172
                  7***********************************************************************************************99 PP

       DUF260  99 ee 100
                  +e
  Pbr022066.1 173 AE 174
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.74774175IPR004883Lateral organ boundaries, LOB
PfamPF031954.3E-4275172IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MEFIAKTTTT PTSPPPFSHS LSSSISSPST APFPSPNSHH LSNYSSPHAA NSNIATNPFP  60
TYPSPPPPPP VVLSPCAACK ILRRRCVEKC VLAPYFPPTE PLKFTIAHRV FGASNIIKLL  120
QEIPESHRAD AVSSMVYEAN ARIRDPVYGC AGAICQLQKQ VGELQAQLAK AQAELVNMQC  180
EQGNLIALIC MDMTQSKEQA ILQQQQSNCN DTSCFPDENN LGTTWEPLWT *
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009378147.11e-170PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR07e-75LBD1_ARATH; LOB domain-containing protein 1
TrEMBLM5X5X51e-103M5X5X5_PRUPE; Uncharacterized protein
STRINGPOPTR_0008s04350.17e-96(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.12e-62LOB domain-containing protein 1